Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (22 PDB entries) |
Domain d3k0jb_: 3k0j B: [247089] automated match to d1dz5a_ protein/RNA complex; complexed with mg, tpp |
PDB Entry: 3k0j (more details), 3.1 Å
SCOPe Domain Sequences for d3k0jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k0jb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa tnalrsmqgfpfydkpmriqyaktdsdiiakm
Timeline for d3k0jb_: