SCOP 1.65: Domain d1ldeb1: 1lde B:1-163,B:340-374

Lineage for d1ldeb1 (1lde B:1-163,B:340-374)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (2 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (7 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Alcohol dehydrogenase [50137] (6 species)
contains a Zn-finger subdomain, residues 94-117
Species Horse (Equus caballus) [TaxId:9796] [50138] (31 PDB entries)
Domain d1ldeb1: 1lde B:1-163,B:340-374 [24687]
Other proteins in same PDB: d1ldea2, d1ldeb2, d1ldec2, d1lded2

Details for d1ldeb1

PDB Entry: 1lde (more details), 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and n-formyl piperdine

SCOP Domain Sequences for d1ldeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldeb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOP Domain Coordinates for d1ldeb1:

Click to download the PDB-style file with coordinates for d1ldeb1.
(The format of our PDB-style files is described here.)

Timeline for d1ldeb1: