Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.21: NQO2-like [142405] (2 proteins) complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle automatically mapped to Pfam PF01257 |
Protein automated matches [254686] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255884] (3 PDB entries) |
Domain d3iam2_: 3iam 2: [246780] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug21 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam2_ c.47.1.21 (2:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} gffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevm gvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqk veclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
Timeline for d3iam2_: