Lineage for d2oxib1 (2oxi B:1-174,B:325-374)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13364Protein Alcohol dehydrogenase [50137] (4 species)
  7. 13368Species Horse (Equus caballus) [TaxId:9796] [50138] (22 PDB entries)
  8. 13380Domain d2oxib1: 2oxi B:1-174,B:325-374 [24672]
    Other proteins in same PDB: d2oxia2, d2oxib2

Details for d2oxib1

PDB Entry: 2oxi (more details), 2.1 Å

PDB Description: refined crystal structure of cu-substituted alcohol dehydrogenase at 2.1 angstroms resolution

SCOP Domain Sequences for d2oxib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxib1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d2oxib1:

Click to download the PDB-style file with coordinates for d2oxib1.
(The format of our PDB-style files is described here.)

Timeline for d2oxib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oxib2