Lineage for d3i3ga_ (3i3g A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664985Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries)
  8. 1664986Domain d3i3ga_: 3i3g A: [246709]
    automated match to d3fb3b_

Details for d3i3ga_

PDB Entry: 3i3g (more details), 1.86 Å

PDB Description: crystal structure of trypanosoma brucei n-acetyltransferase (tb11.01.2886) at 1.86a
PDB Compounds: (A:) n-acetyltransferase

SCOPe Domain Sequences for d3i3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3ga_ d.108.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vdlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchqptgriv
gsaslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcykvildss
ekslpfyeklgfraherqmrldl

SCOPe Domain Coordinates for d3i3ga_:

Click to download the PDB-style file with coordinates for d3i3ga_.
(The format of our PDB-style files is described here.)

Timeline for d3i3ga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i3gb_