Lineage for d1lepc_ (1lep C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797353Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 797354Family b.35.1.1: GroES [50130] (2 proteins)
  6. 797355Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 797406Species Mycobacterium leprae [TaxId:1769] [50133] (1 PDB entry)
  8. 797409Domain d1lepc_: 1lep C: [24651]
    CA-atoms only

Details for d1lepc_

PDB Entry: 1lep (more details), 3.5 Å

PDB Description: three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae
PDB Compounds: (C:) chaperonin-10

SCOP Domain Sequences for d1lepc_:

Sequence, based on SEQRES records: (download)

>d1lepc_ b.35.1.1 (C:) Chaperonin-10 (GroES) {Mycobacterium leprae [TaxId: 1769]}
akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
dvsegdiviyskyggteikyngeeylilsardvlavvsk

Sequence, based on observed residues (ATOM records): (download)

>d1lepc_ b.35.1.1 (C:) Chaperonin-10 (GroES) {Mycobacterium leprae [TaxId: 1769]}
akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
kyngeeylilsardvlavvsk

SCOP Domain Coordinates for d1lepc_:

Click to download the PDB-style file with coordinates for d1lepc_.
(The format of our PDB-style files is described here.)

Timeline for d1lepc_: