SCOPe 2.07: Domain d3fvdb1: 3fvd B:2-127

Lineage for d3fvdb1 (3fvd B:2-127)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)

8. Domain d3fvdb1: 3fvd B:2-127 [246190]
   Other proteins in same PDB: d3fvda2, d3fvda3, d3fvda4, d3fvdb2, d3fvdb3, d3fvdb4
   automated match to d2qdda1
   complexed with mg

Details for d3fvdb1

PDB Entry: 3fvd, 2.3 Å

PDB Description: crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fvdb1:

Sequence, based on SEQRES records:

>d3fvdb1 d.54.1.0 (B:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsylpah
gpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglpl
wqllgg

Sequence, based on observed residues (ATOM records):

>d3fvdb1 d.54.1.0 (B:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrltvfhldlplakpywlslkfdrldstylridtdegvtgwgegcpwghsylpahgpg
lragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplwql
lgg

Timeline for d3fvdb1:

• d3fvdb1 first appeared in SCOPe 2.04
  
• d3fvdb1 appears in SCOPe 2.06
  
• d3fvdb1 appears in the current release, SCOPe 2.08