SCOP 1.55: Domain d1mnd_1: 1mnd 34-79

Lineage for d1mnd_1 (1mnd 34-79)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.34: SH3-like barrel [50036] (7 superfamilies)

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)

8. Domain d1mnd_1: 1mnd 34-79 [24591]
   Other proteins in same PDB: d1mnd_2

Details for d1mnd_1

PDB Entry: 1mnd, 2.6 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-alf4

SCOP Domain Sequences for d1mnd_1:

Sequence, based on SEQRES records:

>d1mnd_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Sequence, based on observed residues (ATOM records):

>d1mnd_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvqdrqvkkddanq

Timeline for d1mnd_1:

• d1mnd_1 appears in SCOP 1.57
  
• d1mnd_1 appears in the current release, SCOPe 2.08, called d1mnda1