Lineage for d1mmd_1 (1mmd 34-79)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227771Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 227772Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 227773Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 227800Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)
  8. 227806Domain d1mmd_1: 1mmd 34-79 [24578]
    Other proteins in same PDB: d1mmd_2
    complexed with adp, bef, mg; mutant

Details for d1mmd_1

PDB Entry: 1mmd (more details), 2 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-bef3

SCOP Domain Sequences for d1mmd_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmd_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOP Domain Coordinates for d1mmd_1:

Click to download the PDB-style file with coordinates for d1mmd_1.
(The format of our PDB-style files is described here.)

Timeline for d1mmd_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmd_2