Lineage for d1vom_1 (1vom 34-79)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227771Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 227772Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 227773Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 227800Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)
  8. 227803Domain d1vom_1: 1vom 34-79 [24577]
    Other proteins in same PDB: d1vom_2
    complexed with adp, mg, vo4

Details for d1vom_1

PDB Entry: 1vom (more details), 1.9 Å

PDB Description: complex between dictyostelium myosin and mgadp and vanadate at 1.9a resolution

SCOP Domain Sequences for d1vom_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vom_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOP Domain Coordinates for d1vom_1:

Click to download the PDB-style file with coordinates for d1vom_1.
(The format of our PDB-style files is described here.)

Timeline for d1vom_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vom_2