Class b: All beta proteins [48724] (119 folds) |
Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (3 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries) |
Domain d1vom_1: 1vom 34-79 [24577] Other proteins in same PDB: d1vom_2 complexed with adp, mg, vo4 |
PDB Entry: 1vom (more details), 1.9 Å
SCOP Domain Sequences for d1vom_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vom_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)} yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq
Timeline for d1vom_1: