Lineage for d3c3id_ (3c3i D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427795Species Paramecium bursaria chlorella virus il3a [TaxId:46019] [255769] (3 PDB entries)
  8. 2427799Domain d3c3id_: 3c3i D: [245457]
    automated match to d3ehwa_
    complexed with dud, mg

Details for d3c3id_

PDB Entry: 3c3i (more details), 3 Å

PDB Description: evolution of chlorella virus dutpase
PDB Compounds: (D:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d3c3id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3id_ b.85.4.0 (D:) automated matches {Paramecium bursaria chlorella virus il3a [TaxId: 46019]}
ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria
prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva
vvldlsdtar

SCOPe Domain Coordinates for d3c3id_:

Click to download the PDB-style file with coordinates for d3c3id_.
(The format of our PDB-style files is described here.)

Timeline for d3c3id_: