Lineage for d1awwa_ (1aww A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392560Protein Bruton's tyrosine kinase [50068] (1 species)
  7. 2392561Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)
  8. 2392562Domain d1awwa_: 1aww A: [24529]

Details for d1awwa_

PDB Entry: 1aww (more details)

PDB Description: sh3 domain from bruton's tyrosine kinase, nmr, 42 structures
PDB Compounds: (A:) bruton's tyrosine kinase

SCOPe Domain Sequences for d1awwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
vteaeds

SCOPe Domain Coordinates for d1awwa_:

Click to download the PDB-style file with coordinates for d1awwa_.
(The format of our PDB-style files is described here.)

Timeline for d1awwa_: