Class b: All beta proteins [48724] (119 folds) |
Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (24 proteins) |
Protein Bruton's tyrosine kinase [50068] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries) |
Domain d1aww__: 1aww - [24529] |
PDB Entry: 1aww (more details)
SCOP Domain Sequences for d1aww__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aww__ b.34.2.1 (-) Bruton's tyrosine kinase {Human (Homo sapiens)} gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny vteaeds
Timeline for d1aww__: