![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
![]() | Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
![]() | Protein Cytochrome c oxidase subunit E [48481] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries) |
![]() | Domain d3asne_: 3asn E: [245205] Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ automated match to d1ocre_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3asn (more details), 3 Å
SCOPe Domain Sequences for d3asne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asne_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d3asne_:
![]() Domains from other chains: (mouse over for more information) d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ |