Lineage for d1ark__ (1ark -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372467Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 372468Family b.34.2.1: SH3-domain [50045] (33 proteins)
  6. 372707Protein SH3 domain from nebulin [50050] (1 species)
  7. 372708Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries)
  8. 372709Domain d1ark__: 1ark - [24473]

Details for d1ark__

PDB Entry: 1ark (more details)

PDB Description: sh3 domain from human nebulin, nmr, 15 structures

SCOP Domain Sequences for d1ark__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ark__ b.34.2.1 (-) SH3 domain from nebulin {Human (Homo sapiens)}
tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai

SCOP Domain Coordinates for d1ark__:

Click to download the PDB-style file with coordinates for d1ark__.
(The format of our PDB-style files is described here.)

Timeline for d1ark__: