![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (33 proteins) |
![]() | Protein SH3 domain from nebulin [50050] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries) |
![]() | Domain d1ark__: 1ark - [24473] |
PDB Entry: 1ark (more details)
SCOP Domain Sequences for d1ark__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ark__ b.34.2.1 (-) SH3 domain from nebulin {Human (Homo sapiens)} tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai
Timeline for d1ark__: