SCOPe 2.07: Domain d2yaaa_: 2yaa A:

Lineage for d2yaaa_ (2yaa A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (41 PDB entries)

8. Domain d2yaaa_: 2yaa A: [244716]
   automated match to d2x0ga_
   complexed with atp, ca, so4

Details for d2yaaa_

PDB Entry: 2yaa, 2.3 Å

PDB Description: crystal structure of the autoinhibited form of mouse dapk2 in complex with atp

PDB Compounds: (A:) Death-associated protein kinase 2

SCOPe Domain Sequences for d2yaaa_:

Sequence; same for both SEQRES and ATOM records:

>d2yaaa_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
etfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreei
erevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
sqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv

Timeline for d2yaaa_:

• d2yaaa_ first appeared in SCOPe 2.04
  
• d2yaaa_ appears in SCOPe 2.06
  
• d2yaaa_ appears in the current release, SCOPe 2.08