Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (7 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189349] (15 PDB entries) |
Domain d2y8ba_: 2y8b A: [244709] automated match to d4fr7a_ complexed with zn |
PDB Entry: 2y8b (more details), 1.7 Å
SCOPe Domain Sequences for d2y8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y8ba_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} eyptvddipvgevrlykigdgvwshiatqklgdtvyssnglivrdadelllidtawgakn tvallaeiekqiglpvtrsisthfhddrvggvdvlraagvatytspltrqlaeaagnevp ahslkalsssgdvvrfgpvevfypgaahsgdnlvvyvpavrvlfggcavheasresagnv adanlaewpatikriqqrypeaevvipghglpgglellqhttnvvk
Timeline for d2y8ba_: