Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries) |
Domain d2wsda1: 2wsd A:2-182 [244275] automated match to d1gska1 complexed with cu, edo, oxy; mutant |
PDB Entry: 2wsd (more details), 1.6 Å
SCOPe Domain Sequences for d2wsda1:
Sequence, based on SEQRES records: (download)
>d2wsda1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr l
>d2wsda1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsdgypeawfskd feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl
Timeline for d2wsda1: