Lineage for d1ekmc1 (1ekm C:237-672)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795366Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 795367Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 795368Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 795462Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 795477Domain d1ekmc1: 1ekm C:237-672 [24415]
    Other proteins in same PDB: d1ekma2, d1ekma3, d1ekmb2, d1ekmb3, d1ekmc2, d1ekmc3
    complexed with zn

Details for d1ekmc1

PDB Entry: 1ekm (more details), 2.5 Å

PDB Description: crystal structure at 2.5 a resolution of zinc-substituted copper amine oxidase of hansenula polymorpha expressed in escherichia coli
PDB Compounds: (C:) copper amine oxidase

SCOP Domain Sequences for d1ekmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekmc1 b.30.2.1 (C:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOP Domain Coordinates for d1ekmc1:

Click to download the PDB-style file with coordinates for d1ekmc1.
(The format of our PDB-style files is described here.)

Timeline for d1ekmc1: