Lineage for d2wbkb3 (2wbk B:331-678)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2439949Species Bacteroides thetaiotaomicron [TaxId:226186] [255614] (7 PDB entries)
  8. 2439963Domain d2wbkb3: 2wbk B:331-678 [244103]
    Other proteins in same PDB: d2wbka1, d2wbka2, d2wbka4, d2wbka5, d2wbkb1, d2wbkb2, d2wbkb4, d2wbkb5, d2wbkb6
    automated match to d2je8a5
    complexed with br, cl, edo, m2f

Details for d2wbkb3

PDB Entry: 2wbk (more details), 2.1 Å

PDB Description: structure of the michaelis complex of beta-mannosidase, man2a, provides insight into the conformational itinerary of mannoside hydrolysis
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2wbkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbkb3 c.1.8.3 (B:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsqfgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap

SCOPe Domain Coordinates for d2wbkb3:

Click to download the PDB-style file with coordinates for d2wbkb3.
(The format of our PDB-style files is described here.)

Timeline for d2wbkb3: