Lineage for d2rpva_ (2rpv A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541749Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2541750Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2541879Protein automated matches [190067] (6 species)
    not a true protein
  7. 2541906Species Streptococcus sp. [TaxId:1320] [255506] (3 PDB entries)
  8. 2541909Domain d2rpva_: 2rpv A: [243743]
    automated match to d2qmta_
    complexed with la

Details for d2rpva_

PDB Entry: 2rpv (more details)

PDB Description: solution structure of gb1 with lbt probe
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2rpva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rpva_ d.15.7.1 (A:) automated matches {Streptococcus sp. [TaxId: 1320]}
cyvdtnndgayegdelsgtmeyklilngktlkgetttcavdaataekvfkqyandngvdg
ewtyddatktftvte

SCOPe Domain Coordinates for d2rpva_:

Click to download the PDB-style file with coordinates for d2rpva_.
(The format of our PDB-style files is described here.)

Timeline for d2rpva_: