SCOPe 2.04: Domain d2m87a_: 2m87 A:

Lineage for d2m87a_ (2m87 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:1185418] [255488] (1 PDB entry)

8. Domain d2m87a_: 2m87 A: [243136]
   automated match to d1gxpb_

Details for d2m87a_

PDB Entry: 2m87

PDB Description: structural basis of dna recognition by the effector domain of klebsiella pneumoniae pmra

PDB Compounds: (A:) Transcriptional regulatory protein basR/pmrA

SCOPe Domain Sequences for d2m87a_:

Sequence; same for both SEQRES and ATOM records:

>d2m87a_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1185418]}
nqgdneisvgnlrlnvtrrlvwlgetaldltpkeyallsrlmmkagspvhreilyndiys
wdnepatntlevhihnlrekigksrirtvrgfgymlannidte

Timeline for d2m87a_:

• d2m87a_ is new in SCOPe 2.04-stable
  
• d2m87a_ appears in SCOPe 2.05
  
• d2m87a_ appears in the current release, SCOPe 2.08