Class g: Small proteins [56992] (91 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
Protein automated matches [190785] (4 species) not a true protein |
Species Mycobacterium ulcerans [TaxId:362242] [255482] (1 PDB entry) |
Domain d2m4ya_: 2m4y A: [243108] automated match to d2v3bb_ |
PDB Entry: 2m4y (more details)
SCOPe Domain Sequences for d2m4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m4ya_ g.41.5.1 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]} mtayrcpvcdytydegkgdpregfpagtrwdqipddwccpdcsvrekvdfermggk
Timeline for d2m4ya_: