Lineage for d2m4ya_ (2m4y A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1705991Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1706113Protein automated matches [190785] (4 species)
    not a true protein
  7. 1706120Species Mycobacterium ulcerans [TaxId:362242] [255482] (1 PDB entry)
  8. 1706121Domain d2m4ya_: 2m4y A: [243108]
    automated match to d2v3bb_

Details for d2m4ya_

PDB Entry: 2m4y (more details)

PDB Description: Rubredoxin type protein from Mycobacterium ulcerans
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2m4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m4ya_ g.41.5.1 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
mtayrcpvcdytydegkgdpregfpagtrwdqipddwccpdcsvrekvdfermggk

SCOPe Domain Coordinates for d2m4ya_:

Click to download the PDB-style file with coordinates for d2m4ya_.
(The format of our PDB-style files is described here.)

Timeline for d2m4ya_: