SCOPe 2.04: Domain d2l8ja_: 2l8j A:

Lineage for d2l8ja_ (2l8j A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (11 PDB entries)

8. Domain d2l8ja_: 2l8j A: [242808]
   automated match to d3wana_

Details for d2l8ja_

PDB Entry: 2l8j

PDB Description: gabarapl-1 nbr1-lir complex structure

PDB Compounds: (A:) Gamma-aminobutyric acid receptor-associated protein-like 1

SCOPe Domain Sequences for d2l8ja_:

Sequence; same for both SEQRES and ATOM records:

>d2l8ja_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gspefkfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdlt
vgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesvy

Timeline for d2l8ja_:

• d2l8ja_ is new in SCOPe 2.04-stable
  
• d2l8ja_ appears in SCOPe 2.05
  
• d2l8ja_ appears in the current release, SCOPe 2.08, called d2l8ja1