Lineage for d2kxpa_ (2kxp A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1695098Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
    3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha
  4. 1695099Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) (S)
  5. 1695100Family e.43.1.1: Capz alpha-1 subunit [90097] (1 protein)
    automatically mapped to Pfam PF01267
  6. 1695101Protein Capz alpha-1 subunit [90098] (1 species)
  7. 1695102Species Chicken (Gallus gallus) [TaxId:9031] [90099] (10 PDB entries)
  8. 1695113Domain d2kxpa_: 2kxp A: [242692]
    Other proteins in same PDB: d2kxpb_, d2kxpc_
    automated match to d1izna_

Details for d2kxpa_

PDB Entry: 2kxp (more details)

PDB Description: Solution NMR structure of V-1 bound to capping protein (CP)
PDB Compounds: (A:) F-actin-capping protein subunit alpha-1

SCOPe Domain Sequences for d2kxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kxpa_ e.43.1.1 (A:) Capz alpha-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
rvsdeekvriaakfithappgefnevfndvrlllnndnllregaahafaqynmdqftpvk
iegyddqvlitehgdlgngrfldprnkisfkfdhlrkeasdpqpedtesalkqwrdacds
alrayvkdhypngfctvygksidgqqtiiacieshqfqpknfwngrwrsewkftitppta
qvaavlkiqvhyyedgnvqlvshkdiqdsvqvssdvqtakefikiienaeneyqtaisen
yqtmsdttfkalrrqlpvtrtkidwnkilsykigk

SCOPe Domain Coordinates for d2kxpa_:

Click to download the PDB-style file with coordinates for d2kxpa_.
(The format of our PDB-style files is described here.)

Timeline for d2kxpa_: