Lineage for d2knfa_ (2knf A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703146Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1703147Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1703148Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1703193Protein Plasminogen [63400] (1 species)
  7. 1703194Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 1703224Domain d2knfa_: 2knf A: [242581]
    automated match to d1b2ia_

Details for d2knfa_

PDB Entry: 2knf (more details)

PDB Description: solution structure and functional characterization of human plasminogen kringle 5
PDB Compounds: (A:) plasminogen

SCOPe Domain Sequences for d2knfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knfa_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
snadcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdg
dvggpwcyttnprklydycdvpqcaa

SCOPe Domain Coordinates for d2knfa_:

Click to download the PDB-style file with coordinates for d2knfa_.
(The format of our PDB-style files is described here.)

Timeline for d2knfa_: