SCOPe 2.04: Domain d2k4ja_: 2k4j A:

Lineage for d2k4ja_ (2k4j A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (12 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [255221] (3 PDB entries)

8. Domain d2k4ja_: 2k4j A: [242376]
   automated match to d1odda_

Details for d2k4ja_

PDB Entry: 2k4j

PDB Description: arsr dna binding domain

PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2k4ja_:

Sequence; same for both SEQRES and ATOM records:

>d2k4ja_ a.4.6.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
gseevsepgdanifrvdkdsrevymhekkldltraeyeilslliskkgyvfsresiaies
esinpessnksidviigrlrskieknpkqpqyiisvrgigykley

Timeline for d2k4ja_:

• d2k4ja_ is new in SCOPe 2.04-stable
  
• d2k4ja_ appears in SCOPe 2.05
  
• d2k4ja_ appears in the current release, SCOPe 2.08, called d2k4ja1