Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (22 PDB entries) |
Domain d2k03a_: 2k03 A: [242330] automated match to d2nwga_ |
PDB Entry: 2k03 (more details)
SCOPe Domain Sequences for d2k03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k03a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpvslsyrcpcrffeshvaranvkhlkilntpncacqivarlknnnrqvcidpklkwiqe ylekclnk
Timeline for d2k03a_: