SCOPe 2.04: Domain d2k03a_: 2k03 A:

Lineage for d2k03a_ (2k03 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein automated matches [190403] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187277] (22 PDB entries)

8. Domain d2k03a_: 2k03 A: [242330]
   automated match to d2nwga_

Details for d2k03a_

PDB Entry: 2k03

PDB Description: structure of sdf1 in complex with the cxcr4 n-terminus containing a sulfotyrosine at postition 21

PDB Compounds: (A:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d2k03a_:

Sequence; same for both SEQRES and ATOM records:

>d2k03a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpvslsyrcpcrffeshvaranvkhlkilntpncacqivarlknnnrqvcidpklkwiqe
ylekclnk

Timeline for d2k03a_:

• d2k03a_ is new in SCOPe 2.04-stable
  
• d2k03a_ appears in SCOPe 2.05
  
• d2k03a_ appears in the current release, SCOPe 2.08