SCOPe 2.07: Domain d2jv9a1: 2jv9 A:6-119

Lineage for d2jv9a1 (2jv9 A:6-119)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries)

8. Domain d2jv9a1: 2jv9 A:6-119 [242290]
   Other proteins in same PDB: d2jv9a2
   automated match to d1bhdb_

Details for d2jv9a1

PDB Entry: 2jv9

PDB Description: the solution structure of calponin homology domain from smoothelin- like 1

PDB Compounds: (A:) Smoothelin-like 1

SCOPe Domain Sequences for d2jv9a1:

Sequence; same for both SEQRES and ATOM records:

>d2jv9a1 a.40.1.0 (A:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakrrhnft
lafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk

Timeline for d2jv9a1:

• d2jv9a1 first appeared in SCOPe 2.04, called d2jv9a_
  
• d2jv9a1 appears in SCOPe 2.06
  
• d2jv9a1 appears in the current release, SCOPe 2.08