SCOPe 2.04: Domain d2jtga_: 2jtg A:

Lineage for d2jtga_ (2jtg A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (9 PDB entries)

8. Domain d2jtga_: 2jtg A: [242286]
   automated match to d2d8ra1
   complexed with zn

Details for d2jtga_

PDB Entry: 2jtg

PDB Description: solution structure of the thap-zinc finger of thap1

PDB Compounds: (A:) THAP domain-containing protein 1

SCOPe Domain Sequences for d2jtga_:

Sequence; same for both SEQRES and ATOM records:

>d2jtga_ g.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvqscsaygcknrydkdkpvsfhkfpltrpslckeweaavrrknfkptkyssicsehftp
dcfkrecnnkllkenavptiflelvpr

Timeline for d2jtga_:

• d2jtga_ is new in SCOPe 2.04-stable
  
• d2jtga_ appears in SCOPe 2.05
  
• d2jtga_ appears in the current release, SCOPe 2.08, called d2jtga1