Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (6 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries) |
Domain d2joma_: 2jom A: [242256] automated match to d3o79b_ mutant |
PDB Entry: 2jom (more details)
SCOPe Domain Sequences for d2joma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2joma_ d.6.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} lggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitv kqhtvttttkgenftetdikimervveqmcvtqyqqesqaayqra
Timeline for d2joma_: