Lineage for d1gana_ (1gan A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226891Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 226911Protein S-lectin, different isoforms [49933] (4 species)
  7. 226941Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)
  8. 226944Domain d1gana_: 1gan A: [24214]

Details for d1gana_

PDB Entry: 1gan (more details), 2.23 Å

PDB Description: complex of toad ovary galectin with n-acetylgalactose

SCOP Domain Sequences for d1gana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gana_ b.29.1.3 (A:) S-lectin, different isoforms {Toad (Bufo arenarum)}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
lsleglqfksitte

SCOP Domain Coordinates for d1gana_:

Click to download the PDB-style file with coordinates for d1gana_.
(The format of our PDB-style files is described here.)

Timeline for d1gana_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ganb_