SCOPe 2.08: Domain d2he0a1: 2he0 A:50-243

Lineage for d2he0a1 (2he0 A:50-243)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)

8. Domain d2he0a1: 2he0 A:50-243 [242026]
   Other proteins in same PDB: d2he0a2, d2he0b2
   automated match to d2f8yb_
   complexed with edo; mutant
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2he0a1

PDB Entry: 2he0, 1.9 Å

PDB Description: crystal structure of a human notch1 ankyrin domain mutant

PDB Compounds: (A:) Notch1 preproprotein variant

SCOPe Domain Sequences for d2he0a1:

Sequence; same for both SEQRES and ATOM records:

>d2he0a1 d.211.1.1 (A:50-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hnqtdrtgatalhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqil
irnratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnn
vdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdi
aqermhhdivrlld

Timeline for d2he0a1:

• d2he0a1 first appeared in SCOPe 2.04, called d2he0a_
  
• d2he0a1 appears in SCOPe 2.07