Lineage for d2h5ua3 (2h5u A:301-499)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382487Species Trametes maxima [TaxId:259368] [255201] (1 PDB entry)
  8. 2382490Domain d2h5ua3: 2h5u A:301-499 [242005]
    automated match to d1kyaa3
    complexed with cu, nag

Details for d2h5ua3

PDB Entry: 2h5u (more details), 1.9 Å

PDB Description: crystal structure of laccase from cerrena maxima at 1.9a resolution
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2h5ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5ua3 b.6.1.0 (A:301-499) automated matches {Trametes maxima [TaxId: 259368]}
netnlhplvstpvpgspaaggvdkainmafnfngsnffingasftppsvpvllqilsgaq
taqdllpsgsvytlpsnasieisfpataaapgaphpfhlhghvfavvrsagstvynysnp
ifrdvvstgtpaagdnvtirfltnnpgpwflhchidfhleggfavvqaedvpdvkatnpv
pqawsdlcptydanapsdq

SCOPe Domain Coordinates for d2h5ua3:

Click to download the PDB-style file with coordinates for d2h5ua3.
(The format of our PDB-style files is described here.)

Timeline for d2h5ua3: