Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Trametes maxima [TaxId:259368] [255201] (1 PDB entry) |
Domain d2h5ua3: 2h5u A:301-499 [242005] automated match to d1kyaa3 complexed with cu, nag |
PDB Entry: 2h5u (more details), 1.9 Å
SCOPe Domain Sequences for d2h5ua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5ua3 b.6.1.0 (A:301-499) automated matches {Trametes maxima [TaxId: 259368]} netnlhplvstpvpgspaaggvdkainmafnfngsnffingasftppsvpvllqilsgaq taqdllpsgsvytlpsnasieisfpataaapgaphpfhlhghvfavvrsagstvynysnp ifrdvvstgtpaagdnvtirfltnnpgpwflhchidfhleggfavvqaedvpdvkatnpv pqawsdlcptydanapsdq
Timeline for d2h5ua3: