![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
![]() | Protein automated matches [190506] (3 species) not a true protein |
![]() | Species Orf virus [TaxId:10259] [255191] (1 PDB entry) |
![]() | Domain d2gnnb_: 2gnn B: [241938] automated match to d1wq8a_ complexed with ben, cl, gol, nag, so4, trs |
PDB Entry: 2gnn (more details), 2.3 Å
SCOPe Domain Sequences for d2gnnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gnnb_ g.17.1.0 (B:) automated matches {Orf virus [TaxId: 10259]} ntkgwsevlkgseckprpivvpvsethpeltsqrfnppcvtlmrcggccndeslecvpte evnvtmellgasgsgsngmqrlsfvehkkcdcrpr
Timeline for d2gnnb_: