Lineage for d2gnnb_ (2gnn B:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703674Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 1703675Protein automated matches [190506] (3 species)
    not a true protein
  7. 1703712Species Orf virus [TaxId:10259] [255191] (1 PDB entry)
  8. 1703714Domain d2gnnb_: 2gnn B: [241938]
    automated match to d1wq8a_
    complexed with ben, cl, gol, nag, so4, trs

Details for d2gnnb_

PDB Entry: 2gnn (more details), 2.3 Å

PDB Description: crystal structure of the orf virus nz2 variant of vegf-e
PDB Compounds: (B:) Vascular endothelial growth factor homolog

SCOPe Domain Sequences for d2gnnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnnb_ g.17.1.0 (B:) automated matches {Orf virus [TaxId: 10259]}
ntkgwsevlkgseckprpivvpvsethpeltsqrfnppcvtlmrcggccndeslecvpte
evnvtmellgasgsgsngmqrlsfvehkkcdcrpr

SCOPe Domain Coordinates for d2gnnb_:

Click to download the PDB-style file with coordinates for d2gnnb_.
(The format of our PDB-style files is described here.)

Timeline for d2gnnb_: