Lineage for d1slcb_ (1slc B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2388881Protein Galectin-1 [100925] (5 species)
  7. 2388885Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 2388889Domain d1slcb_: 1slc B: [24189]
    complexed with bma, gal, man, nag, ndg

Details for d1slcb_

PDB Entry: 1slc (more details), 2.15 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides
PDB Compounds: (B:) bovine galectin-1

SCOPe Domain Sequences for d1slcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slcb_ b.29.1.3 (B:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOPe Domain Coordinates for d1slcb_:

Click to download the PDB-style file with coordinates for d1slcb_.
(The format of our PDB-style files is described here.)

Timeline for d1slcb_: