Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein Galectin-1 [100925] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries) |
Domain d1slcb_: 1slc B: [24189] complexed with bma, gal, man, nag, ndg |
PDB Entry: 1slc (more details), 2.15 Å
SCOPe Domain Sequences for d1slcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1slcb_ b.29.1.3 (B:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]} acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl saggdfkikcvafe
Timeline for d1slcb_: