SCOPe 2.07: Domain d2fyha1: 2fyh A:1-184

Lineage for d2fyha1 (2fyh A:1-184)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (6 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [255177] (1 PDB entry)

8. Domain d2fyha1: 2fyh A:1-184 [241886]
   Other proteins in same PDB: d2fyha2
   automated match to d1vgja_

Details for d2fyha1

PDB Entry: 2fyh

PDB Description: Solution structure of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus

PDB Compounds: (A:) putative integral membrane transport protein

SCOPe Domain Sequences for d2fyha1:

Sequence; same for both SEQRES and ATOM records:

>d2fyha1 d.61.1.0 (A:1-184) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikki
lekiakkykkhevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkeg
nfvahitlgrvkfvkdklglamklkelanedfgsfiveaielkkstltpkgpiyetlarf
else

Timeline for d2fyha1:

• d2fyha1 first appeared in SCOPe 2.04, called d2fyha_
  
• d2fyha1 appears in SCOPe 2.06
  
• d2fyha1 appears in the current release, SCOPe 2.08