Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Solanum lycopersicum [TaxId:4081] [255174] (1 PDB entry) |
Domain d2fona3: 2fon A:462-656 [241871] Other proteins in same PDB: d2fona1, d2fonb1, d2fonc1 automated match to d1w07a2 complexed with fad |
PDB Entry: 2fon (more details), 2.74 Å
SCOPe Domain Sequences for d2fona3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fona3 a.29.3.0 (A:462-656) automated matches {Solanum lycopersicum [TaxId: 4081]} ehlmqcrsdvkqaedwlkpsavleafearsarmsvacaknlskfenqeegfaelaadlve aavahcqlivvskyieklqqnipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskq gslandqlralysqlrpnavslvdafnytdhylgsilgrydgnvypklyeaawkdplnks diadgfheyirpllk
Timeline for d2fona3: