Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries) |
Domain d2dh9a1: 2dh9 A:540-615 [241566] Other proteins in same PDB: d2dh9a2, d2dh9a3 automated match to d2ywka_ |
PDB Entry: 2dh9 (more details)
SCOPe Domain Sequences for d2dh9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dh9a1 d.58.7.0 (A:540-615) automated matches {Human (Homo sapiens) [TaxId: 9606]} ifvrnlpfdftwkmlkdkfnecghvlyadikmengkskgcgvvkfespevaeracrmmng mklsgreidvridrna
Timeline for d2dh9a1: