Lineage for d2db8a1 (2db8 A:8-104)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2372249Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2372250Protein automated matches [190976] (5 species)
    not a true protein
  7. 2372274Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries)
  8. 2372413Domain d2db8a1: 2db8 A:8-104 [241542]
    Other proteins in same PDB: d2db8a2, d2db8a3
    automated match to d1uema_

Details for d2db8a1

PDB Entry: 2db8 (more details)

PDB Description: solution structures of the fn3 domain of human tripartite motif protein 9
PDB Compounds: (A:) Tripartite motif protein 9, isoform 2

SCOPe Domain Sequences for d2db8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2db8a1 b.1.2.0 (A:8-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvpatpilqleeccthnnsatlswkqpplstvpadgyilelddgnggqfrevyvgketmc
tvdglhfnstynarvkafnktgvspysktlvlqtseg

SCOPe Domain Coordinates for d2db8a1:

Click to download the PDB-style file with coordinates for d2db8a1.
(The format of our PDB-style files is described here.)

Timeline for d2db8a1: