Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries) |
Domain d2db8a1: 2db8 A:8-104 [241542] Other proteins in same PDB: d2db8a2, d2db8a3 automated match to d1uema_ |
PDB Entry: 2db8 (more details)
SCOPe Domain Sequences for d2db8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2db8a1 b.1.2.0 (A:8-104) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvpatpilqleeccthnnsatlswkqpplstvpadgyilelddgnggqfrevyvgketmc tvdglhfnstynarvkafnktgvspysktlvlqtseg
Timeline for d2db8a1: