SCOPe 2.07: Domain d2d9za1: 2d9z A:8-123

Lineage for d2d9za1 (2d9z A:8-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d2d9za1: 2d9z A:8-123 [241530]
   Other proteins in same PDB: d2d9za2, d2d9za3
   automated match to d2coaa1

Details for d2d9za1

PDB Entry: 2d9z

PDB Description: solution structure of the ph domain of protein kinase c, nu type from human

PDB Compounds: (A:) Protein kinase C, nu type

SCOPe Domain Sequences for d2d9za1:

Sequence; same for both SEQRES and ATOM records:

>d2d9za1 b.55.1.0 (A:8-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvkegwmvhytsrdnlrkrhywrldskcltlfqnesgskyykeiplseilrissprdftn
isqgsnphcfeiitdtmvyfvgenngdsshnpvlaatgvgldvaqswekairqalm

Timeline for d2d9za1:

• d2d9za1 first appeared in SCOPe 2.04, called d2d9za_
  
• d2d9za1 appears in SCOPe 2.06
  
• d2d9za1 appears in the current release, SCOPe 2.08