SCOPe 2.07: Domain d2c6qa1: 2c6q A:10-336

Lineage for d2c6qa1 (2c6q A:10-336)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families)
   The phosphate moiety of substrate binds in the 'common' phosphate-binding site

5. Family c.1.5.0: automated matches [227276] (1 protein)
   not a true family

6. Protein automated matches [227084] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries)

8. Domain d2c6qa1: 2c6q A:10-336 [241417]
   Other proteins in same PDB: d2c6qa2, d2c6qb2, d2c6qc2, d2c6qd2, d2c6qe2, d2c6qf2, d2c6qg2, d2c6qh2
   automated match to d2bzna_
   complexed with imp, ndp

Details for d2c6qa1

PDB Entry: 2c6q, 1.7 Å

PDB Description: crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph

PDB Compounds: (A:) GMP reductase 2

SCOPe Domain Sequences for d2c6qa1:

Sequence; same for both SEQRES and ATOM records:

>d2c6qa1 c.1.5.0 (A:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlck
fslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicld
vangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttr
kktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghs
esggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgdvehtirdil
ggirstctyvgaaklkelsrrttfirv

Timeline for d2c6qa1:

• d2c6qa1 first appeared in SCOPe 2.04, called d2c6qa_
  
• d2c6qa1 appears in SCOPe 2.06
  
• d2c6qa1 appears in the current release, SCOPe 2.08