Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (4 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (36 PDB entries) |
Domain d2bysh_: 2bys H: [241383] automated match to d2c9ta_ complexed with lob |
PDB Entry: 2bys (more details), 2.05 Å
SCOPe Domain Sequences for d2bysh_:
Sequence, based on SEQRES records: (download)
>d2bysh_ b.96.1.0 (H:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrer
>d2bysh_ b.96.1.0 (H:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwkln slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr qvqhysccpepyidvnlvvkfrer
Timeline for d2bysh_: