Lineage for d2a24a_ (2a24 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577113Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 2577117Protein automated matches [191006] (1 species)
    not a true protein
  7. 2577118Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries)
  8. 2577141Domain d2a24a_: 2a24 A: [241184]
    Other proteins in same PDB: d2a24b_
    automated match to d1p97a_

Details for d2a24a_

PDB Entry: 2a24 (more details)

PDB Description: haddock structure of hif-2a/arnt pas-b heterodimer
PDB Compounds: (A:) Endothelial PAS domain protein 1

SCOPe Domain Sequences for d2a24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a24a_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktflsrhsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlctkgq
vvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseie

SCOPe Domain Coordinates for d2a24a_:

Click to download the PDB-style file with coordinates for d2a24a_.
(The format of our PDB-style files is described here.)

Timeline for d2a24a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a24b_