SCOPe 2.07: Domain d1yq1b2: 1yq1 B:79-205

Lineage for d1yq1b2 (1yq1 B:79-205)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [224980] (2 PDB entries)

8. Domain d1yq1b2: 1yq1 B:79-205 [241052]
   Other proteins in same PDB: d1yq1a1, d1yq1b1
   automated match to d2on5a2

Details for d1yq1b2

PDB Entry: 1yq1, 3 Å

PDB Description: Structural Genomics Of Caenorhabditis Elegans: glutathione S-Transferase

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1yq1b2:

Sequence, based on SEQRES records:

>d1yq1b2 a.45.1.0 (B:79-205) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
agktpeeeawvdavhdlfkdflaefkkfaaerrsgksaeevekfrsefflparntyfnil
nglleksnsgfligsditfadlvvvdnlltlknyglfdeseftklaalrekvnsypgike
yiakrpv

Sequence, based on observed residues (ATOM records):

>d1yq1b2 a.45.1.0 (B:79-205) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
agktpeeeawvdavhdlfkdflaefkkfaaerrsgevekfrsefflparntyfnilngll
eksnsgfligsditfadlvvvdnlltlknyglfdeseftklaalrekvnsypgikeyiak
rpv

Timeline for d1yq1b2:

• d1yq1b2 first appeared in SCOPe 2.04
  
• d1yq1b2 appears in SCOPe 2.06
  
• d1yq1b2 appears in the current release, SCOPe 2.08