Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (8 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [254983] (1 PDB entry) |
Domain d1ylbb_: 1ylb B: [241043] automated match to d1ag6a_ complexed with cu1 |
PDB Entry: 1ylb (more details)
SCOPe Domain Sequences for d1ylbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylbb_ b.6.1.1 (B:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee dllnapgetykvtltekgtykfycsphqgagmvgkvtvn
Timeline for d1ylbb_: