SCOPe 2.04: Domain d1ylbb_: 1ylb B:

Lineage for d1ylbb_ (1ylb B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (8 species)
   not a true protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [254983] (1 PDB entry)

8. Domain d1ylbb_: 1ylb B: [241043]
   automated match to d1ag6a_
   complexed with cu1

Details for d1ylbb_

PDB Entry: 1ylb

PDB Description: nmr solution structure of the reduced spinach plastocyanin

PDB Compounds: (B:) Plastocyanin, chloroplast

SCOPe Domain Sequences for d1ylbb_:

Sequence; same for both SEQRES and ATOM records:

>d1ylbb_ b.6.1.1 (B:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

Timeline for d1ylbb_:

• d1ylbb_ is new in SCOPe 2.04-stable
  
• d1ylbb_ appears in SCOPe 2.05
  
• d1ylbb_ appears in the current release, SCOPe 2.08