Lineage for d1yhuu_ (1yhu U:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475749Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1475750Protein automated matches [190590] (15 species)
    not a true protein
  7. 1475852Species Riftia pachyptila [TaxId:6426] [254981] (1 PDB entry)
  8. 1475868Domain d1yhuu_: 1yhu U: [241028]
    automated match to d1x9fb_
    complexed with hem, oxy, zn

Details for d1yhuu_

PDB Entry: 1yhu (more details), 3.15 Å

PDB Description: Crystal structure of Riftia pachyptila C1 hemoglobin reveals novel assembly of 24 subunits.
PDB Compounds: (U:) hemoglobin A1 chain

SCOPe Domain Sequences for d1yhuu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhuu_ a.1.1.0 (U:) automated matches {Riftia pachyptila [TaxId: 6426]}
acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
vcfdvpawqgcyniiakgitgsdaa

SCOPe Domain Coordinates for d1yhuu_:

Click to download the PDB-style file with coordinates for d1yhuu_.
(The format of our PDB-style files is described here.)

Timeline for d1yhuu_: