Lineage for d1sbf__ (1sbf -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Legume lectin [49904] (20 species) 
Species Soybean (Glycine max) [TaxId:3847] [49913] (5 PDB entries) 
Domain d1sbf__: 1sbf - [24102]
Details for d1sbf__
PDB Entry: 1sbf (more details), 2.42 Å
PDB Description: soybean agglutinin
SCOP Domain Sequences for d1sbf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbf__ b.29.1.1 (-) Legume lectin {Soybean (Glycine max)}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph
SCOP Domain Coordinates for d1sbf__:
Click to download the PDB-style file with coordinates for d1sbf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sbf__:
- d1sbf__ first appeared (with stable ids) in SCOP 1.55
- d1sbf__ appears in SCOP 1.59
- d1sbf__ appears in SCOP 1.63
- d1sbf__ appears in the current release, SCOPe 2.08, called d1sbfa_
View in 3D