Lineage for d1x69a_ (1x69 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536554Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1536555Protein automated matches [190457] (8 species)
    not a true protein
  7. 1536598Species Human (Homo sapiens) [TaxId:9606] [187598] (77 PDB entries)
  8. 1536693Domain d1x69a_: 1x69 A: [240957]
    automated match to d1j3ta_

Details for d1x69a_

PDB Entry: 1x69 (more details)

PDB Description: solution structures of the sh3 domain of human src substrate cortactin
PDB Compounds: (A:) cortactin isoform a

SCOPe Domain Sequences for d1x69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x69a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtydeyendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgr
yglfpanyvelrqsgpssg

SCOPe Domain Coordinates for d1x69a_:

Click to download the PDB-style file with coordinates for d1x69a_.
(The format of our PDB-style files is described here.)

Timeline for d1x69a_: