SCOPe 2.07: Domain d1x5ca1: 1x5c A:8-115

Lineage for d1x5ca1 (1x5c A:8-115)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d1x5ca1: 1x5c A:8-115 [240954]
   Other proteins in same PDB: d1x5ca2, d1x5ca3
   automated match to d1meka_

Details for d1x5ca1

PDB Entry: 1x5c

PDB Description: the solution structure of the second thioredoxin-like domain of human protein disulfide-isomerase

PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d1x5ca1:

Sequence; same for both SEQRES and ATOM records:

>d1x5ca1 c.47.1.0 (A:8-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvkvlvgknfedvafdekknvfvefyapwcghckqlapiwdklgetykdheniviakmds
taneveavkvhsfptlkffpasadrtvidyngertldgfkkflesggq

Timeline for d1x5ca1:

• d1x5ca1 first appeared in SCOPe 2.04, called d1x5ca_
  
• d1x5ca1 appears in SCOPe 2.06
  
• d1x5ca1 appears in the current release, SCOPe 2.08